PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_23021
Common NameKK1_023699
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family BBR-BPC
Protein Properties Length: 278aa    MW: 31167.9 Da    PI: 10.1114
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_23021genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind317.54.1e-9712781301
      GAGA_bind   1 mdddgsrernkgyyepaaslkenlglqlmssiaerdaki....rernlalsekkaavaerd.........maflqrdkalaernkalverdnklla 83 
                    mddd  +  n+gyyep      +lglqlm  +++rd+k+    r+  + l++ ++++++rd          ++  rd+++++        ++++++
  C.cajan_23021   1 MDDDVLNMPNWGYYEPF--RGGHLGLQLMPGMNDRDTKPflpgRDPPM-LMGANGTFHPRDcvvseasipLNY-VRDNWISQ--------RDRFFN 84 
                    899988779******98..4579******************9999998.9***********999999999899.89999999........789*** PP

      GAGA_bind  84 lllvenslasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvk 179
                    +++ +         +++vl++t+ + slq      ++++ +   + ek++     e+  ++ke+ ++kkrq+     ++kakk++k    +k++++
  C.cajan_23021  85 MQPPNP--------NYTVLPETSGAPSLQI-----IQPPDTS--RDEKVDRV---EELVVKKEAGQPKKRQTRGALTTPKAKKPRK----PKDNSN 158
                    **9555........4899********9999.....3333333..23322222...2344455555666555555555555555555....222333 PP

      GAGA_bind 180 kesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaae 275
                     +   +r+k +kk+++lv+ng+++D+s+lP+PvCsCtGa++qCY+WG+GGWqSaCCtt++S+yPLP+s krrgaRiagrKmSqgafkk+LekLaae
  C.cajan_23021 159 VSV--QRVKPPKKTMELVINGIDMDISGLPIPVCSCTGAPQQCYRWGCGGWQSACCTTNVSIYPLPMSMKRRGARIAGRKMSQGAFKKVLEKLAAE 252
                    334..6799*************************************************************************************** PP

      GAGA_bind 276 GydlsnpvDLkdhWAkHGtnkfvtir 301
                    Gy+++np+DLk+hWA+HGtnkfvtir
  C.cajan_23021 253 GYNFANPIDLKTHWARHGTNKFVTIR 278
                    *************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012264.3E-1651278IPR010409GAGA-binding transcriptional activator
PfamPF062174.5E-1081278IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MDDDVLNMPN WGYYEPFRGG HLGLQLMPGM NDRDTKPFLP GRDPPMLMGA NGTFHPRDCV  60
VSEASIPLNY VRDNWISQRD RFFNMQPPNP NYTVLPETSG APSLQIIQPP DTSRDEKVDR  120
VEELVVKKEA GQPKKRQTRG ALTTPKAKKP RKPKDNSNVS VQRVKPPKKT MELVINGIDM  180
DISGLPIPVC SCTGAPQQCY RWGCGGWQSA CCTTNVSIYP LPMSMKRRGA RIAGRKMSQG  240
AFKKVLEKLA AEGYNFANPI DLKTHWARHG TNKFVTIR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00253DAPTransfer from AT2G01930Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0962150.0BT096215.1 Soybean clone JCVI-FLGm-15O8 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007158817.10.0hypothetical protein PHAVU_002G184500g
SwissprotQ9SKD01e-109BPC1_ARATH; Protein BASIC PENTACYSTEINE1
TrEMBLA0A151T2P10.0A0A151T2P1_CAJCA; Uncharacterized protein
STRINGGLYMA08G09780.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23703283
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14685.31e-109basic pentacysteine 2